SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW005746-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW005746-PA
Domain Number 1 Region: 70-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-37
Family SPRY domain 0.0019
Further Details:      
 
Domain Number 2 Region: 244-278
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000902
Family SOCS box-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW005746-PA
Sequence length 361
Comment SPRY domain SOCS box-containing protein|DS741094:214625:226831:-1|gene:ISCW005746
Sequence
MRLPNDPSERESSCRPVDHRISAAVPPSAIAAVGSARTASLHLSSPPQLLRGSPTGIVAA
PWSWGVEDESWAWNSKHKSSEVSLLGPRRAQFHPQWSSGTAGVRGVRPLPRGRRAYWEVR
VSQRVFGTSMMWGLCTARARLHADAFVDLLGQDQHGWGLSHKGLVWHAGRWRAFTRPFRE
NQATVVGMLFDGRRGTLTYYKDGRCLGVAFRDLHLVGEPLYPAACSTAAKTEMSLANARR
DFAGLQDRCRAVILRHAGPDAIRQLRLPPRLERYLLHQEEPPQEPFHLEPSDTTTTQHDS
SPPSPQRALPLRAPSLPLQCGYLRAHRCWLVVSACTFYLFCYLTGTGLLFKIINIEGERE
R
Download sequence
Identical sequences B7PLM6
XP_002434674.1.51680 6945.ISCW005746-PA ISCW005746-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]