SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006055-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006055-PA
Domain Number 1 Region: 78-232
Classification Level Classification E-value
Superfamily L domain-like 0.0000000068
Family Ngr ectodomain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW006055-PA
Sequence length 252
Comment hypothetical protein|DS750015:7921:8679:1|gene:ISCW006055
Sequence
MTSVSFVATLLLSVQALLCRNLVQSVCPKKEEVHPCNCYGFSSYDRVECRAVEDKQVLKR
ALSKFKGMHIFEFELSLIDMKDVPSDAFKHVQVSELYTYMANFSGLQKSGHLFEGFDSTL
YMLEIKRGINLDDWDWTALARLSNLQRLYIFSSNLRKIDRRFSAVSKSLTHVMIQGGDLE
VIEDGAFTALRLRDLEISYTRLGQVSRQIFPVPATTLSVLSLRYETVACVGDRLEHLHLL
QRERVGKGRGNM
Download sequence
Identical sequences B7PN52
6945.ISCW006055-PA ISCW006055-PA XP_002435200.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]