SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006121-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006121-PA
Domain Number 1 Region: 19-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000368
Family EGF-type module 0.0047
Further Details:      
 
Weak hits

Sequence:  ISCW006121-PA
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000299
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW006121-PA
Sequence length 70
Comment conserved hypothetical protein|DS756350:16656:21034:-1|gene:ISCW006121
Sequence
CRNTLYGPECSCKPGYRLMGDRQACADINECEELPSKCVHRCQNLPGSFRCVCPPGQSIS
EDGRTCQSAR
Download sequence
Identical sequences B7PP87
XP_002435579.1.51680 ISCW006121-PA 6945.ISCW006121-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]