SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006320-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW006320-PA
Domain Number - Region: 10-55
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000455
Family Growth factor receptor domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW006320-PA
Sequence length 59
Comment hypothetical protein|DS748448:24994:35212:1|gene:ISCW006320
Sequence
MFVKPPIPDCAGETCIKLHNERCQEGYECKLNDPEGNIFQGAPGTCVAATPHDHAHHNK
Download sequence
Identical sequences B7PMN1
ISCW006320-PA 6945.ISCW006320-PA XP_002435029.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]