SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006465-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006465-PA
Domain Number 1 Region: 150-316
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000971
Family Fibronectin type III 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW006465-PA
Sequence length 392
Comment hypothetical protein|DS746509:252023:258876:-1|gene:ISCW006465
Sequence
MTSKPAIIFRIAARNDKGYGPATQVRWLQDPLSTLASAAMSTTMPVTTPVVQPEPPPVAP
APKSVALPVLKPAASPAPPQIAAAATNGVAIKTEEGAETKSAIQEAVAKPSPAKRDGMWF
DVGIFKETSCLVSHFYLPSEQTERKDDDVDVVSVPDHSMLQKQELLPGTAYKFRVAAINA
AVGGPGARCLPSRPAAGLPGGPFRHQDQQGPRRSPPVLGGAPGNPGDVTEYSVYLAVRSA
TTGDGAGSAKTVTSNPSQLAFVRVYCGPQAACTVPSASLASAHVDMTSKPAIIFRIAARN
DKGYGPATQVRWLQVTSNPSQLAFVRVYCGPQAACTVPSASLASAHVDMTSKPAIIFRIA
ARNDKGYGPATQVRWLQGAKGAAAKKAKNEDS
Download sequence
Identical sequences B7PMC3
XP_002434921.1.51680 6945.ISCW006465-PA ISCW006465-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]