SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006623-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006623-PA
Domain Number 1 Region: 534-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-106
Family Thrombospondin C-terminal domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 411-530
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-32
Family TSP type-3 repeat 0.00000546
Further Details:      
 
Domain Number 3 Region: 347-413
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.45e-16
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 263-346
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000654
Family TSP type-3 repeat 0.00025
Further Details:      
 
Weak hits

Sequence:  ISCW006623-PA
Domain Number - Region: 177-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 129-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 89-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00274
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 235-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0894
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW006623-PA
Sequence length 789
Comment thrombospondin, putative|DS736694:63668:72686:1|gene:ISCW006623
Sequence
LPDVAAATPSEPPQRDVNSRGYGGEDLNDNRLATRALIDLLELLQESKKAVEVQTRALLM
LTEVLSRCQFCRSRGDDDDVINIGVAAVQCSEKPCFRGVSCRDTRSGFQCGPCPPGYAGD
GGNGSHCEDVDECDAANPCHPHVACINESPGFRCGPCPRGFEGGELRGVGLEFARRARQH
CHDLDECADGRNGGCVPHSRCTNTPGSRVCGECLEGFMGNQTAGCHPRPGTCPDGSLCDG
NADCLPRRGSGTYACRCRVGWAGDGRLCGTDRDLDGWPDASLPCGHRRCRADNCPGTPNS
GQEDADDDGTGDACDEDADDDGVLNSPDNCPLVANPGQEDTDPDGPDHLGDACDNCPTVP
NPDQVDSDGDGLGDLCDPDADDDGVLNERDNCPTTPNADQRDSDGDGLGDACDNCPRAKN
PDQIDSDRDLVGDACDDNIDRDRDGIQDSWDNCPDDANSDQLDTDEDGRGDACDFDKDND
GVPDSADNCALVYNPDQRDTNRTGVGDACKEDFDGDSIPDPLDVCPDNRRVYATDFRAYQ
TVVLDPEGDSQIDPHWVVYNKGAEIVQTMNSDPGLAVGYQKFGGVDFEGTFFVDTEVDDD
YVGFVFGYQDNGRFYAVMWKKSSQTYWQATPFRAVAEPGIQLKLVNSDTGPGETLRNALW
HTGDTHGQVRLLWRDPRNVGWKEKVAYRWLLLHRPALGLVRLRVFEGDQLVADSGNVYDS
TLQGGRLGVFCFSQEAIIWSDLVYRCNEALPETAYRDLPRELRAKARRDNVTPSELPLTP
VPSVNNNLV
Download sequence
Identical sequences B7PKY4
ISCW006623-PA XP_002434432.1.51680 6945.ISCW006623-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]