SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006727-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006727-PA
Domain Number 1 Region: 140-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.056
Further Details:      
 
Domain Number 2 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 227-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 4 Region: 269-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW006727-PA
Sequence length 370
Comment Netrin-4, putative|DS749874:10522:17300:1|gene:ISCW006727
Sequence
MANSPRPGVWVLERSTDEGKTYQAWQYFADSYADCDTYFGPEVEHGISRDDSVICETKFS
KVVPLEGGEMVISLLNGRPSANNFTYSPVLQEWTKATNVRLRLLRTKTLLGHLMSVERQD
PTVTRRYFYSIKDINIGGRCVCNGHADTCDITDPNNPSKLNCSCQHHTCGPQCEQCCPGY
QQNKWQRASIDNPNVCEPCNCFGHSNDCYYDEKVDERQESLNVHGIYDGGGVCRNCQHNT
EGVNCHKCRPGFYRPFNKLLNATDVCQPCRCDLTFSSGNCMEGSGQCECRPEFLPPNCDQ
CNAGYYGYPQCRPCDCHANGTQGRVCQVNGGQCPCRRYYEGKNCDRCSPGYYGFPDCRPL
GLRRIGWGAL
Download sequence
Identical sequences B7PN44
6945.ISCW006727-PA XP_002435192.1.51680 ISCW006727-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]