SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006817-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006817-PA
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000487
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW006817-PA
Sequence length 114
Comment hypothetical protein|DS749409:53652:53996:-1|gene:ISCW006817
Sequence
MSISWFAGPPEPLHSCQICNLTETSLGVSCWTGHGGAPNGASPSTSHSSGTASLNTTYVL
ELYSSQQSSQVLNATSGLPVFSVRNLQPRTEYFIVLYGVNSLGHSNASSSTPAP
Download sequence
Identical sequences B7PMY1
ISCW006817-PA 6945.ISCW006817-PA XP_002435129.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]