SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006897-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006897-PA
Domain Number 1 Region: 139-210
Classification Level Classification E-value
Superfamily L domain-like 8.75e-19
Family Ngr ectodomain-like 0.095
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily L domain-like 0.000000000839
Family Ngr ectodomain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW006897-PA
Sequence length 219
Comment toll, putative|DS780350:19651:22631:-1|gene:ISCW006897
Sequence
MNKVQDITDTFTNLSTLVVLNLTMNEITFIRDGTFLKNSDLAQLYIRNPIVCDCRLSWLI
ATWGTRSPDWAICQGPPRFRGRLLYDLTPEKLKAWPQGCDANCTCECHDDEVFGMDIRVS
CANESLEELPSTFPTETAVLDLSGNRLRQLDDDLAVRSPNLRSLNLANNRLAKFPTDLVS
KMNLSSVWLSGNPWSCDCEDYAFTRWGRDHQGCGKQFFT
Download sequence
Identical sequences B7PSS8
XP_002402933.1.51680 6945.ISCW006897-PA ISCW006897-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]