SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006935-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006935-PA
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily Fibronectin type III 3.82e-22
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 2 Region: 3-38
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000798
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW006935-PA
Sequence length 154
Comment cell adhesion molecule, putative|DS773002:43196:47930:-1|gene:ISCW006935
Sequence
MASQLLIRDVKTNDTGAYACKVANSHGKDEMFIKLTVQAPSAKPVDLKVIPLNSSSLRAT
WKAPSGESKIAGYYVGYKVELDGRSESYVYKTVESRPGVSQECDLKDLRPGTKYTVLVQA
YNGKGPGPSSNEVIGETPSSGKLVVNRTSVRKIS
Download sequence
Identical sequences B7PRJ5
6945.ISCW006935-PA XP_002399906.1.51680 ISCW006935-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]