SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006939-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006939-PA
Domain Number 1 Region: 277-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000159
Family EGF-type module 0.006
Further Details:      
 
Domain Number 2 Region: 431-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000493
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 510-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 241-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000566
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 584-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000553
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 393-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 7 Region: 546-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 8 Region: 471-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 198-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000821
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ISCW006939-PA
Domain Number - Region: 844-892
Classification Level Classification E-value
Superfamily FwdE-like 0.0288
Family FwdE-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW006939-PA
Sequence length 899
Comment protein jagged-2, putative|DS806160:74444:123524:1|gene:ISCW006939
Sequence
MRTFFNDRTSERFQVPEDIKKGPRKRAGGQAGGESQDLELKTRDTDHVIERLAYSGLVLP
SAEWHTLRHPGVRAQLAYRVRVTCAANYYGPSCWSLCKPRDDRFGHYRCSPEGRKVCRPG
WTGSTCESPVCRRGCHPVHGYCDRPGQCLCRPGWKSELCDHCQPYPGCRHGYCNNTPWQC
ICDVNWGGILCDQDLNYCGTHEPCFNGATCEHTIGQDKYLCRCRQGFFGRNCELGQGQAQ
RPCLASPCLNGGTCSERNSTFECACLPGWTGNRCQKNVNECSSSPCLHGGTCLDLVAGYR
CLCQPGWRGSSCETPDDTQASPAKHSGAPDRETPSPCAACPKGSRCVLGPRSQVQHYIND
CATRPCVNGGTAWTAEQLPLPLPDGWEDLLHNNRNECHPNPCHNDGKCTDLIADFLCECQ
GQWKGKTCNLNINDCATRPCVNGGTCVDGLNSYRCLCPDGWEGPHCSNRDSHCDSSTCLN
GGTCEDLGDAFVCHCPENYQGHTCQIAKGSSCESNPCQNGATCVNRGHSFSCICREGFEG
RLCQQNVDDCRGQPCHNGGRCIDGVNWFRCECASGFAGPDCRINVDECASSPCAVGSTCQ
DAIGDYFCSCPPGRTGKRCNVGTVYPEGSRWQLDCTLCSCTSGSVTCSPGPCPESGCDPV
GSTGQCPLGQTCLARAPEACFVNPCPTGGPRGDCSDVANASHAAKPSQCLPNSADPSNNC
AKMTLLFDRRTMTPGTTVESLCNGVRQLSPRPSILILCAQRMADPDSIEVTLSMPGHASA
STYAAVSESARRLADLISRKLTNSTALASVIEVKNEENVRRYCNPIREPTELCELDPRNK
AHLFKALPLDTSKNTNHLAEVTNKQCQKDALLTTRPSTAGPKALLESSDDKLDAVVVLV
Download sequence
Identical sequences B7PW69
ISCW006939-PA XP_002409386.1.51680 6945.ISCW006939-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]