SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007116-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007116-PA
Domain Number 1 Region: 88-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000214
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 173-269
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000103
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 273-372
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000377
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 4 Region: 13-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000013
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW007116-PA
Sequence length 454
Comment limbic system-associated membrane protein, putative|DS787683:335850:371763:1|gene:ISCW007116
Sequence
MHISWLLVEIGICGVHGDDEFIKVWIKNKDILFAGSFRVHPDPRMSLGPDDELKIEGLVS
GDDGVYTCKVNSQIEPNSIQHKLVLPGPPKLKTHPESGEVKVMKGEPFEIGCTASGKPDS
VITWRHMNDSSINVAALVKNNVIQIDSAELKHSGTYECTAANGYGDPVVGFITVSILGKP
TVTTTLQWTAGFAGSLSAELLCVAHSATPSSTRWVRDDGTWLLHGESVHLFTAGNHYTAK
FKEVSERDFGNYTCESKNKFGVTMDTVELSNVPTKPYVVPIEAPNTTTYEISLSTVTPFP
VTKYVLFIRAEKHADEVDEWRNITLPRHHQQKTGSKHATNYLITNLEPGTKYEAYAAVSN
EKGMSRLTDFKFTTASDALQEEIKDDPNAGSSSTQNRALSVHMDLKHKSLQNLECTTDSL
NSSQQYCHVCNNCEGGYYVLHSSLFISDPLNYCW
Download sequence
Identical sequences B7PTR3
6945.ISCW007116-PA XP_002404785.1.51680 ISCW007116-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]