SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007228-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007228-PA
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000791
Family MAM domain 0.024
Further Details:      
 
Weak hits

Sequence:  ISCW007228-PA
Domain Number - Region: 121-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00316
Family MAM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW007228-PA
Sequence length 189
Comment hypothetical protein|DS805685:4509:16702:1|gene:ISCW007228
Sequence
MIVKNRGSLYLTSPMVPRQAQPVCATLRYHFFGGLGAYIRVSLLTDWGDGTPGSVKTTPF
IYQLDRASVDRWFTVRRTLDMRSKSNEVVFRVNVGAGEGYPLSSFGIDDVQLDPEPCRPL
LECDFEEDFCGYVNDFTRRGVQWLVGTGRVAVPKLSPKIPPPHNPSAEASGGEYDSFALL
VQSILKIAI
Download sequence
Identical sequences B7PW60
ISCW007228-PA 6945.ISCW007228-PA XP_002409319.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]