SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007255-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007255-PA
Domain Number 1 Region: 292-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000475
Family Exotoxin A, N-terminal domain 0.087
Further Details:      
 
Weak hits

Sequence:  ISCW007255-PA
Domain Number - Region: 490-525
Classification Level Classification E-value
Superfamily RING/U-box 0.0148
Family RING finger domain, C3HC4 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW007255-PA
Sequence length 525
Comment RING finger and SPRY domain-containing protein, putative|DS799611:181389:210512:-1|gene:ISCW007255
Sequence
MGNLFCCVCKERKSGASDDASNGGYRRRQSSLVAEVGSDGSERRRSSTTFGWHGTRGSLA
APSYVEHLILETLSIIRTLVDNEQEPPPFMIKLHLLADKESGWLLVVKSMVNAIPMEDPL
GPAVITLILDDCPLPTKESVGKLSQMFQLSRELSVGGRSNPTWHRNICVVLGCIAEKLAG
PSSVALLTPDTLEYLVANLDPLNCNTLVILFSLIALEKFAQTSENKMTLERRLAALSENP
LVKMEPWVTSSDFVERQVGFCAQWCLDNLCACLLQGRRYTYEVTDRSNINAMLNSNDVSE
YLKISSNGLVVRMGRCIGALYLSDEGFRGSVILKNFLKSLMVDYFSFSQWKQEGYGIGDD
EFSIAYDGCRQLIWHNALSQGHSHPCWKPGDVLGTLLDVKALEITFYLNGQPLPPNTQVF
PYAKSGFFAAASFMTFQQCEFNFGRSPFRFPPSGVQFSCFNSFAHLSEEDKVILPRHIRM
EKLRHSSVREDSCTLCFDRSAAVRLEPCQHKGFCSHCALQLEVCP
Download sequence
Identical sequences B7PVG8
6945.ISCW007255-PA ISCW007255-PA XP_002407925.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]