SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007282-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007282-PA
Domain Number 1 Region: 177-251
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000685
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 373-563
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000177
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 3 Region: 82-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000863
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 
Domain Number 4 Region: 291-375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000198
Family I set domains 0.046
Further Details:      
 
Domain Number 5 Region: 7-71
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000745
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW007282-PA
Sequence length 626
Comment sidestep protein, putative|DS792316:82473:160178:-1|gene:ISCW007282
Sequence
MFRFCPGRPPPSVTWWRGSTLVDEKFAMTPLDVVRNELVINRLQRADLLATFTCQASNTN
LTLPRSSSVTINMNLRPLDVRIISLKRPLSAGRKVELVCQSSGGRPPPQITWWLGKKKLS
FVRDNVTVNDNYTTSSITFSPSIDDHGKVARRRCRNDEKSNVVNHVPRLSLSLGANMKHK
AIREGSDVYFECNIQANPMVSDVGWKFEGKPLYSNIKQGVIVSNQSLVLQKVRKESRGHY
QCVAANVEGEGESDRVPLRSGSALTKCSSPLSHPDPDTPVCKKRQNLVYGVARDEEAEIS
CEVEADPGELSFKWALNNSVETFDVKTFVVNGTASVATYRPRWKHSYGLLYCWAQNSIGV
QREPCAFHIIPAGPPEAVKNCHVSNQTVTSLSVDCEPGDHGGLRQTFHLEVYNSALELLQ
RNVSSTDGAAFTVRDLPPGTAFILVLYGSNSKGRSNSVSISTNTLPSPERRTGPPEAVKN
CHVSNQTVTSLSVDCEPGDHGGLRQTFHLEVYNSALELLQRNVSSTDGAAFTVRDLPPGT
AFILVLYGSNSKGRSNSVSISTNTLPSPERRTANTDITTVSPVLGVLIGIVGALVLVAIV
IVVVMRLRGDDTEKQVKTTNGKRRMT
Download sequence
Identical sequences B7PUG9
ISCW007282-PA 6945.ISCW007282-PA XP_002406048.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]