SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007404-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW007404-PA
Domain Number - Region: 16-99
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0011
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW007404-PA
Sequence length 105
Comment conserved hypothetical protein|DS798336:21409:22728:1|gene:ISCW007404
Sequence
MKIFILVLLVAVLFNMESADTTVCPPGEHPKACNNWGERNTSCDESTCYSPIPPPCQECK
CYIEDDDYCEAKCVCDGDTFRLPDGTCRDPSECPDGSPGLEYVPK
Download sequence
Identical sequences B7PVA3
XP_002407556.1.51680 ISCW007404-PA 6945.ISCW007404-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]