SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007526-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007526-PA
Domain Number 1 Region: 83-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000164
Family Laminin G-like module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW007526-PA
Sequence length 153
Comment collagen, putative|DS791415:1521:9704:1|gene:ISCW007526
Sequence
MDPPWGVVAVGGSRRCLDRVHVWCVVGLLVVCLHWMVEAQLMPGSADLVALTDLTQLPLG
VDVRTGICEDRPAWLDSQGAPMFPGPDTAWHRLSLSVKGNSVTLVKDCAVRGTEAIDRSD
EALIDHSGIILIGQKFYDDEVYQVRRDSHLVRL
Download sequence
Identical sequences B7PU98
6945.ISCW007526-PA XP_002405774.1.51680 ISCW007526-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]