SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007940-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007940-PA
Domain Number 1 Region: 266-432,472-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.38e-55
Family Tandem AAA-ATPase domain 0.00066
Further Details:      
 
Domain Number 2 Region: 36-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-37
Family SPRY domain 0.0079
Further Details:      
 
Domain Number 3 Region: 2-48
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000363
Family Tandem AAA-ATPase domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW007940-PA
Sequence length 722
Comment DEAD-box protein, putative|DS773663:89313:129582:1|gene:ISCW007940
Sequence
MEWTLPTDVQAEAVPLILGGGDVLMAAETGSGKTGAFCLPILQIVWETLKDEELGRGKKG
GATGAAPATKWGMSFFDRGSALAVSPNGLTTQSRDQKGWHGCRCTKGLQYRGKYYYESKV
TDEGLCRVGWSTLAASLDLGTDRQGFGFGGTGKKSFGKQFDSYGEPFGMHDVIGCYLDLD
AGTIKFSKNGIDLGEAFQIPQNLKRSPFFPAVVLKNAEMEFNLGGTPFKHPPADGFVAVS
EAPKECIVESTVTGTSVGAPKSVKNAPQAIIIEPSRELAEQTLKCITSFKKHLKDPVVRE
LLVIGGVAAKEQIEMLRNGVDIVVGTPGRLEDLISTGELSLTQVRFFVLDEADGLLNGGN
GELINRVHRQIPQITAEGRRLQMVVCSATLHSFEVKKLAERLMHFPTWVDLKGEDSVPET
VHHVVCIVDPRKDTSWMNLSRHIVTDAVHERDNIRPGATTPETLSEAVKLLKGEYVVRAI
QQQNMDQGIIFCRTKVDCDNLESYLNQIGAANRNKSQFSCVCLHGDRKPQERKANLETFK
KGGVKFLICTDVAARGIDITGVPFVINVTLPDEKSNYVHRIGRVGRAERMGLAISLASAV
PEKASQMVWYHSNCSSKGRNCFNTNLTDRGGCCIWYNEPQYLSDIEDHLNVTIQQVEPDL
KIPADEFDGKVVYGQKRTQAGTMYETHTAQMAPTVQELAQMERKSQSLFIERYYLKDQSF
LR
Download sequence
Identical sequences B7PRM5
6945.ISCW007940-PA ISCW007940-PA XP_002400271.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]