SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008184-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008184-PA
Domain Number 1 Region: 18-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-58
Family Calnexin/calreticulin 0.0000548
Further Details:      
 
Domain Number 2 Region: 202-314
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.44e-44
Family P-domain of calnexin/calreticulin 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW008184-PA
Sequence length 413
Comment calreticulin, putative|DS777384:242648:244044:1|gene:ISCW008184
Sequence
MRIVCLLLLLVGTVFADPKVYLKEEFADGDAWTSRWVHSTKKGSEQGTFKLSAGKFHGDP
EKDLGIQTSEDARFYGLSTKFEPFSNDGKTLVVQFTVKHEQNIDCGGGYVKLFDCSLDQK
EMHGESPYHIMFGPDICGPGTKKVHVIFNYKGKNLLINKEIRCKDDVYTHLYTLIVKPDN
TYTVKIDNEVVESGELEKDWSFLPPKKIKDPAAKKPEDWDDRAKIDDPEDTKPEDWDQPE
YIPDPDATKPEDWDDEMDGEWEPPQINNPAFKGEWKPKQIDNPAYKGAWVHPEIDNPEYS
PDPKLHSYKEICTLGFDLWQVKSGTIFDNILLTDDEEYARQYGEETWGATKDAEKKMKEQ
QDEKEDKEAEKKDKEDEKDEDFEEEDDEDKKEDEEAPAGGDAEEEHKHDHEEL
Download sequence
Identical sequences Q68HD1
XP_002402080.1.51680 ISCW008184-PA 6945.ISCW008184-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]