SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008401-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008401-PA
Domain Number 1 Region: 702-876
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-20
Family MAM domain 0.0051
Further Details:      
 
Domain Number 2 Region: 658-695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 175-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000087
Family MAM domain 0.025
Further Details:      
 
Domain Number 4 Region: 543-638
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000206
Family MAM domain 0.016
Further Details:      
 
Domain Number 5 Region: 316-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000744
Family MAM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ISCW008401-PA
Domain Number - Region: 884-957
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00013
Family MAM domain 0.029
Further Details:      
 
Domain Number - Region: 438-526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000316
Family MAM domain 0.021
Further Details:      
 
Domain Number - Region: 404-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000589
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 65-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0538
Family MAM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008401-PA
Sequence length 964
Comment apical endosomal glycoprotein precursor, putative|DS807745:543:102218:1|gene:ISCW008401
Sequence
MELRQVDYKDESGVPSTLQTVQLPAAEAWQTTQLKLKPSQDSQIIIALTRGKGSNGIAAV
GVISGRFIYAEHLGAKYATARLKSPEIPTDVRNEFCVSLWHAALPRTKGFISLNDTVWSN
PLLRDHSRTIHHWAHDLVQMKLPEDVDRFTIDAHMISGLIALDDLVLTPGQCPMPNKCTF
EIFSPCRFNTEFTSPRLWYIGRSRVLNIPDHTMQDSTGHFLYVNTTVVDPAHPEARVFLE
HRGPSPATCVTFWWKGIGKPSDLNLVFEAVSFPYFSGQSGVMVDDVEFTDGECPPESHYL
LFRGTGNVIDSAVLELRERRFQCASFWYFISESSSGCRIEVGDNVLRNATQGWKHYTSDL
SLSWVLQYGVTIRAYSGTDDTAFVAIDDIRVDERRCTEHDTVITDDFVCSITTEETVPMD
KVCNFVKDCSNGVDEADCGSCDFRSTPCGWDLGRLRDKGLPSWQRRQVGEIPGSPKLNHD
DTTNGFYMIFAGEEESKHVVERAIASAPIIRNTDYLCLFTFWYNYASRFLIFRSSETAVK
SEIAGPILQANDTCAITFFYTIYNGASSRLILGVRHTIGGPLTEIWSTGKLDTSFDFLGH
FEYLREERPFQVFFKGEHRATDEASYIAIDDVSFTSGCRPYHGTLPIEPPTPAPTDTPTC
PQGQFVCVTSRQCIPQSQVCDFKQHCPDGSDERDCGSLISTGACDFSTDLCGLRTDNPDA
KYTWNRISAKDVSKKPAGNYGLPKTDSTNDPDGFYCAFRHTNRGPYMYITNHGAEEGRGH
LVSKRLGASGPAGRCFSFWYNMRHPNSGRLSLLARSEDNSTELLWTRSGPQGRAWLRGYA
DAHSDSYSHFVLEAVLPGSTPAVIAVDHIDVRGGECKSKGKYARLAKSYGRLVSPEVRVP
PSAGRCVKFWYYLSGGDGEQLNVSRVTDFQREEPIWSVLASQGPPMTWLSGSVNLLGHQG
PLAR
Download sequence
Identical sequences B7PWF1
6945.ISCW008401-PA ISCW008401-PA XP_002409744.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]