SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008479-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008479-PA
Domain Number 1 Region: 58-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000855
Family MAM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008479-PA
Sequence length 203
Comment secreted protein, putative|DS784338:20866:33967:1|gene:ISCW008479
Sequence
MAKISTALIVALCVAGGLASALVKNQAHFKTHVDALVPDEAPQEIFPEPPLEPEVTVFMC
TFEHHACGMRNQRNTQSRFKRKSEMLAGKPGFHMVVDAQKAGYNVARLITPYMPVYANTT
ACVAIAYVVNGPGADRLEIVAQDSDNRHLLTLPNGASNWRHVEQSINVTQDVRFFISAYT
KSNAEGVIAIDNFRFHLSPCFKN
Download sequence
Identical sequences B7PT84
XP_002404024.1.51680 ISCW008479-PA 6945.ISCW008479-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]