SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008499-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008499-PA
Domain Number 1 Region: 34-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ISCW008499-PA
Domain Number - Region: 70-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0174
Family MAM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW008499-PA
Sequence length 120
Comment mam domain-containing protein, putative|DS817992:194479:199526:1|gene:ISCW008499
Sequence
LNFLGIYSRRDAGYFVIDTIDYVDCGLPQPEHSCEDGFRCANGACISRLDVCNYVDHCGD
GSDELNCDHSMGCNFDTSFCDWKPIVPSEHRSAYLKWVRSRPGSYLRLSPTRDHTTGLPE
Download sequence
Identical sequences B7PY40
XP_002402546.1.51680 6945.ISCW008499-PA ISCW008499-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]