SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008500-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008500-PA
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000981
Family MAM domain 0.0083
Further Details:      
 
Domain Number 2 Region: 112-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000237
Family MAM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008500-PA
Sequence length 172
Comment apical endosomal glycoprotein precursor, putative|DS817992:229312:243360:1|gene:ISCW008500
Sequence
PYMFIRNPWAVEASGHLVSKKVEASGPNGRCFSFWYNMRHPNSGTLNLYLRTADNSSDLI
WTRSGPQGRAWLRGYADTFSDTLGNAVFTGSTSGNSHAAVAVDDVVIDPYGCPAGSCQFE
EDFCNWRNFGTNSNTMRWYRNSGPTMSAGGPSVDHTLKTEKGKSFNAWEPIT
Download sequence
Identical sequences B7PY41
ISCW008500-PA XP_002402547.1.51680 6945.ISCW008500-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]