SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008501-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008501-PA
Domain Number 1 Region: 52-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 132-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family EGF-type module 0.029
Further Details:      
 
Domain Number 3 Region: 95-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW008501-PA
Sequence length 236
Comment low-density lipoprotein receptor, putative|DS817992:248909:262487:1|gene:ISCW008501
Sequence
RVSSTEVPLTTLDSGTSSTDTTPTKTAPIVESTTSEATSESVSTTSAEPRTPPVLACRPG
EFNCRDGEHCIPSALLCDGVKDCPNGLDEKCGALNQCEQSSVFCPSGSPDRCIGRDLLCN
GRVDCTDGSDESLCGNCPASFCLNGGHCDVVNDGRPTCTCPDGASGERCQNIARGSADLQ
QHSTSSTGWAIAVPVLLILVGVAIIGFLYQRRRKAMRRSPPLILNNPSYDTSFSET
Download sequence
Identical sequences B7PY42
6945.ISCW008501-PA ISCW008501-PA XP_002402548.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]