SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008504-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008504-PA
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-18
Family MAM domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW008504-PA
Sequence length 177
Comment conserved hypothetical protein|DS817992:316402:319066:-1|gene:ISCW008504
Sequence
MDFESGMNRRWKMSGWQVTNGKSATEPDGDHTTGAGVGSFALLRRTDGDFSSPSLKMTQP
RCLKFWHYLSGANTEQLEIRNTHSAATKPGTLWRIDASQVPQSRWLSASVTLDQSPNNVI
VTFAGSRSDGSSAVVAVDDVVIGDGVCPPPGSCDFEDDFCNWRNANLNPDMMHWYQN
Download sequence
Identical sequences B7PY44
ISCW008504-PA 6945.ISCW008504-PA XP_002402550.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]