SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008505-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008505-PA
Domain Number 1 Region: 344-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 446-486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 17-108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000135
Family MAM domain 0.0088
Further Details:      
 
Domain Number 4 Region: 248-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000301
Family MAM domain 0.01
Further Details:      
 
Domain Number 5 Region: 485-630
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000728
Family MAM domain 0.0084
Further Details:      
 
Domain Number 6 Region: 216-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000115
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ISCW008505-PA
Domain Number - Region: 384-433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0665
Family MAM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008505-PA
Sequence length 630
Comment low-density lipoprotein receptor, putative|DS817992:340121:388053:-1|gene:ISCW008505
Sequence
MIMGGSVHTASRVSLESRRPTTASCLTFWWKGFGEASDLNVYKYTAETVLRDPIASVRTR
QSSWWNVRSVTVSSRNNWMPVFEAVSAESVRQQSGIMLDDIEITTGACLPDSYYLLFKST
GDRADSALLMLRDQRYRCATLWYFLSKSDTGCRIRIGTEQRTNATKLWTRVQFGLKQGPI
PVGIHVNCGRDKEAFAAIDDLMVDEKECWQLAQSTEVFNCGDAEKRSVPVDRVCNFVWDC
PNGADEQNCGTCDFATDTCGWNVESGLNKGKQSWVRKRAGELEESPPVDWTGSSKGYYLL
NHAGQLLQGHRGEAIAVAPTIRNTNYMCVLQFWYNYASERRQRTECSKGEFSCGNGVCID
ERDVCNYVDNCGDGSDERNCADHNLGCNFDTSFCDWVPLVPRGDFRGFWQRALPVLYPNS
GPTRDHTTGLPEGTLPAAPPAPVTTSAPVCPEGTFSCGGGTEECIPQSQVCDFKRQCSDG
SDEAQCGACDFSQDMCGLTSRDPNSKYLWNRISTQDVAKGPNKELPIKDRNNNPQGFYVA
YTNTNKDVPYRRNDLLTPILGRIAHSCIVSFYSFMKPKWVMTLRFGVEENDTSLMIPGLH
KTFAEVEGHNTWTRSAVKVGNWNPGYRVRF
Download sequence
Identical sequences B7PY45
XP_002402551.1.51680 6945.ISCW008505-PA ISCW008505-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]