SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008507-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008507-PA
Domain Number 1 Region: 124-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000013
Family MAM domain 0.014
Further Details:      
 
Domain Number 2 Region: 31-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000222
Family MAM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008507-PA
Sequence length 230
Comment conserved hypothetical protein|DS817992:445933:463052:-1|gene:ISCW008507
Sequence
MSSPKLKGLGGKQCLRFYYFMPTYPSIMGNDNHTLEVSMLGSYLYISTYNSLKGAEAQLL
SDIVISDVKTTHCMSFWYIVAGDKSGRLRLDFNCSIDKGLHPGFYCAVDAVQLSDCTRPE
GQYRQECDFEQGLCSWRNVRDRFNKLLPWVVHGGSIKSTLRHPSVDHTHGNRTGSYLYIS
TYNSLKGAEAQLLSDIVISDVKTTHCMSFWYIVAGDKSGSTQRRHWLTID
Download sequence
Identical sequences B7PY46
ISCW008507-PA XP_002402552.1.51680 6945.ISCW008507-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]