SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008508-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008508-PA
Domain Number 1 Region: 127-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-29
Family MAM domain 0.0041
Further Details:      
 
Domain Number 2 Region: 86-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 299-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 344-374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008508-PA
Sequence length 377
Comment low-density lipoprotein receptor, putative|DS817992:568449:585067:-1|gene:ISCW008508
Sequence
MYTPAPYLAAVNVHVKHSGTQNKVETLFSKTKGFVHQRWVQELVRVGRRTEFGLIVEGIW
GYAGHATTYLDDFVFQKCTSDHHVSSCASSEWMCADRDKCVAVYERCDGKRDCTDGSDEM
QCLSEYGDCNFDMEDWTTACNWTVDTVDGKPSWTRAKESHSEDTGPPSSHQGRPGTFFLV
ANSSWLPEGSPAVARSPVFPASHNKCHLRFWYYMKGSLSMDYLRVSMLISGASLPMWQDV
GNRGARWLYGHAVVGHSEPFNVVFEAHRGGDAITDIAIDDVSFTSSCSEGGDPTGHPSLC
TEEEFLCKDKSMCVPRDFVCDCQADCPDGSDETDCGEPRIRVQSFVSCMDGEHCIPALLL
CDGVRDCPDGADEHCGQ
Download sequence
Identical sequences B7PY47
6945.ISCW008508-PA XP_002402553.1.51680 ISCW008508-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]