SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008509-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008509-PA
Domain Number 1 Region: 343-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-30
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 144-305
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-26
Family MAM domain 0.01
Further Details:      
 
Domain Number 3 Region: 539-693
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-23
Family MAM domain 0.0029
Further Details:      
 
Domain Number 4 Region: 5-103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000125
Family MAM domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008509-PA
Sequence length 694
Comment apical endosomal glycoprotein precursor, putative|DS817992:612293:674425:-1|gene:ISCW008509
Sequence
GRRALARMVSAGINATGDRGRCLGFWYQLVVSNAGYLSVNTIDANRTLTGVWFKMGSQGD
AWVKGEVNIKTEVPVKIWITGYPGLKVRVDVAIDDIQVFNGKCPDDSTPTNPPDDPGTPD
ADTTSPALPAHDLLLSDGDCPRMGRCDFEKDMCGWDNKGGSEANRNWVRNSGSTPSAGTG
PFADHTLGTADGTYVYLDGRSVEANETLTGVLVSQPWFAGVPYCLSFWAHINVENGTDVP
SLRINTNRTDWEQLWEVKGERGQLWIRAAVPYHSDGPFRFVLEGTLGGGYASDLARGDIS
LSPGCVPYNRTLPLPPPPPLPQCRRGQFPYDVLLEAGPCRRAGFCNFETDFCTWTPTTEG
LTLGWTRQNGQTAAGAAPFVDHTLQSADGYFALAVPKRQGDRARLTSPRYESAGDRCLRF
WFNMAGPKAGELSVYQTVNGSARRENLKPVWRRSGDHLGIWRKGHAALPRLNNYHIIVIQ
AKAGQDRNGAWAVDDVSFTDGCMLSRDASLPTLLPKTTPVPTVKPCLDSEFACSDGKSVC
ATCSFDNGTCGWQDVSIGRYSWVRLRTSPKGIEPTADVSGKGFFMSVEEGDGSESELAVL
RSNEHGPMPCVVTFHTYMFGRHVLMLSLHRTFSKEDDEGEELWSQKGPQGDFWVRRSVDV
THETNSQLVFAVRSGTGPSDVIALDDVSFGDSCT
Download sequence
Identical sequences B7PY48
ISCW008509-PA XP_002402554.1.51680 6945.ISCW008509-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]