SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008511-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008511-PA
Domain Number 1 Region: 220-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000144
Family MAM domain 0.041
Further Details:      
 
Domain Number 2 Region: 115-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000823
Family MAM domain 0.027
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000744
Family MAM domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW008511-PA
Sequence length 389
Comment hypothetical protein|DS817992:755808:782092:-1|gene:ISCW008511
Sequence
MFQGSIQDSEDGYMALDDIAVYVNESCSNLPRDNAARNRGDYFYMDCSFLGSANDTVVAL
ELRSPTLPALSEPVCLSFHYYMFGAGPRRLVLKHLSESSNSTLFQQIGCTTADRCGNLTS
PSFGDKQRPRCLELWHYGDETKDSSLWAGILLKTGPAEILWTRPGSVPTTSWALARVEVP
EQKGDFQVFISGSINATSNSTAVVAVDNVRLTLEPCPHVASCDFEEDLCGYENDFMPPFK
WLVGSGRMAGSASPKIPGLVPLGGGSAVPRWFAYVDTSKPIKGPNLTATLRSAIFQADDN
STVLLRFLRTGKAIQSMEVRLNAWHPNGSKTVKSWTLGEGEDWQSFEQELQPSDETQLEV
SVTRSGQTGGIAALASIAIGHIRTRGELK
Download sequence
Identical sequences B7PY50
ISCW008511-PA 6945.ISCW008511-PA XP_002402556.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]