SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW009461-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW009461-PA
Domain Number - Region: 126-170
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000107
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 40-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00038
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW009461-PA
Sequence length 182
Comment hypothetical protein|DS829927:64585:69382:1|gene:ISCW009461
Sequence
MKTTKSGQDLVLGPMQAPRLVVALLVIASSDSLVLMSKNVQQHRIRLSSFVTLPCTARNE
VRVQDALWLDVRARGRLRKGSVSSASGHLRFDDVSRDLSGLYECVALVRTPKREVFVKTR
HDVQDVCRPGTFSPGASFKTCIPCEYNTYAPHHGSAFCFWCPPGTSTYKQQAESLKDCED
LF
Download sequence
Identical sequences B7Q053
XP_002406886.1.51680 6945.ISCW009461-PA ISCW009461-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]