SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW009606-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW009606-PA
Domain Number - Region: 43-115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW009606-PA
Sequence length 245
Comment hypothetical protein|DS840700:285053:298983:1|gene:ISCW009606
Sequence
MYRCYDSDKTFKLDVKASSRDYVFRTHDAVAIDYKISTFADTQQCERDADCSPKHGPLST
CRDGHCSCLVGHVMTDDVCGPVSCLTDVECSDAGTRCVGGECACSGDFDLVGHRCRKSEE
LLISVKLVICCLGLVAGIAVFTAVSLTFLKNKAGFYLASSIETHKADDDDEDTIVTTATA
EDDAVTLQLDRSQGQSQAEGQDEGLPTIFFRALFPTLSGGLFGEPADPNRISFGNTEVSG
STIDI
Download sequence
Identical sequences B7Q212
XP_002410333.1.51680 ISCW009606-PA 6945.ISCW009606-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]