SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW009631-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW009631-PA
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-26
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW009631-PA
Sequence length 235
Comment conserved hypothetical protein|DS812874:6346:9920:1|gene:ISCW009631
Sequence
MTPTGPVPPRPEVDDIQIHDVELSWSKPTDKEHEIIEYQVIISGSNEFLTPNTSANISNL
QSWTEYTVNVSSCTAESACGPPKTSNFKTDADAPSVPLDLNYTSVGKTWVALNWSHPDTP
NGPLSGFNMSWTNSSFTSSALITSSQFNITHLDQGCSYSISVFAFNNGLKAVKAGPSTNI
TSTFAILPGCTLCPTTIVMMIVIPVICIVLIAAYVLYRRALRKREERALLSSEDT
Download sequence
Identical sequences B7PXA9
6945.ISCW009631-PA ISCW009631-PA XP_002399913.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]