SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW009659-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW009659-PA
Domain Number 1 Region: 131-220
Classification Level Classification E-value
Superfamily Immunoglobulin 9.34e-16
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 28-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000211
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 214-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000121
Family I set domains 0.033
Further Details:      
 
Domain Number 4 Region: 311-397
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000601
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW009659-PA
Sequence length 528
Comment sidestep protein, putative|DS826020:28685:75361:-1|gene:ISCW009659
Sequence
MQLHDSDLEAGLEPETLEISWPAHALKPSMVRIRSKQRPLAAGLAAEIECEAAGSRPAPA
VSWWRGKAKIPMDHVKVMLIGNRIFSVVAYTPTREDNGKRLRCVAENPNIVGSSIEASYN
LDVHFTSPGTEHNEIFEGQDVYLECSIDANPRVSEVVWRFEDNQEVHSDPAAKVITSNQS
LVFQAIQRQNAGRYVCVAINSEGESISNEVQLSVQYSPVCSSRQRTVYPAAAHEMLQVSC
DVDAHPSAVGFHWSFNGSLRNHEVQTFVSEGTRSIASYVPREKADYGSLFCWAANKIGRQ
KTPCEFKVLPVGPPRAPYNCTLSNQTEEAFLAECREDHSGGLRQRYNLEVHDISCHRLLA
NLTADRPAFWVQGVPAGLNYVLVLYAANEMGRSQPVLLRAEAADRYWDGARHGAEWGGCE
QGNSLVVILVAVTLSTVFLLLLLVVVARCRSKKRLKANSGDKIVQNGKTSPRTCDGSVTL
TTFNCVDGEELRPTVLDTSPTKPPFHADYITDVNNHTPAFWRQKIVDF
Download sequence
Identical sequences B7PZK0
6945.ISCW009659-PA XP_002405318.1.51680 ISCW009659-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]