SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010024-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010024-PA
Domain Number 1 Region: 106-294
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000673
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 2 Region: 419-606
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000128
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010024-PA
Sequence length 761
Comment hypothetical protein|DS845050:227455:253787:1|gene:ISCW010024
Sequence
MKDLGLFFVCLGSLMSPEFSYGDVPVMENHYMLNPVDPNLIHPGLHDRETRKQAEAITWT
SPTPTATPKQAYPSVNDVKGPHFLPRNFTAVLDKQNCEDETAKNRTASVRISWSAPQNKT
FKVDSYVVHVRGVNGDQDYMVIINGSEEFNEVTENLECGLLYVFNVQAQYKIERKSAAGK
TDFAYVRTPKEVATLYTDRRSDIYAPRDLKMKVVYASCGEESWIRTASIILRWTPPENTS
VPVHSYIANAINVDDGRTDNNIIINDPEAVKQEFEGFKCGTRYILTLQARYLVTFTSALT
GGLSQYTFESSPSTVKVSIGERDELTTVAYYTPEASSRAPTTPSSARTSFQTKITAHPGL
HDKETRKPAESTTWTSPTQTPKQTYPSINDIKGPQFLPRNFTAALDKQNCEDMTAKNRTA
SVRISWAAPQNKTFKVDSYVVHVRGVNGDQDYMVIINGSEEFNEVTENLKCGQLYVFNVQ
AQYKIERKSAEGKTDFAYVRTAKEIATLYTDRRSDIYAPRDLEAKVVYASCGKESWIRTA
SIMLRWTPPENTSVPVHSYIANAINVDDGRTDKNIIINDPKAVKQEFEGFQCGTRYILTL
RARYLVTNTSAIKGKLTQYTFVSSPSAVKFSIGEGDELTTVAYYTPEVSSRAPTTAHVTD
RVSSPHPGHETSGHSHSQETTSHVGVSITTETSKSNSTDVSRAPHKDEISSKQAGMSTSK
ILMMVLIPLALIALGVAGFFAYKKAQRGRERGILSNTDDQH
Download sequence
Identical sequences B7Q2S0
XP_002410950.1.51680 ISCW010024-PA 6945.ISCW010024-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]