SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010030-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010030-PA
Domain Number 1 Region: 305-480
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-26
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 2 Region: 122-280
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-25
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 7-180
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-22
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 490-578
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000354
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010030-PA
Sequence length 729
Comment cell adhesion molecule, putative|DS835801:9989:70756:1|gene:ISCW010030
Sequence
MTRSFARQASFTWLPPATPNGRIREYGVAYRPLRLVLPCSPIEQTENNLIVPISSQRVNL
EGLHPYTVYAISVHAVTVKPGPEFSTNFTTEQAVPEGTPTALNYSKGTGEEHVIFWGPVP
CELANGVVRRYYLELDSADPWESRLLNHTTGDMRLGFSDLLPYTRYRAKVFAENDAGRSE
VAAELNFTTSPAAPSEVRQLQVTRSFARQATFTWLPPATPNGRIREYGVAYRPLRPVLPC
SPIEQTENNLIVPMSSQRVNLEELHPYTVYTISVHAVTVEPGPEITTNFTTEQAVPEGTS
TALNYSKTTGDEYVIFWGPVPCELANGVVRRYYVELDSPDPWESRLLNHTTGDMRLVFSD
LLPFTRYRAKVFAENDAGRSQVAAELNFTTSPAAPSEVRQLQMTRRFARQASFTWLPPAT
PNGRIREYGVAYRPLRLGLPCSPIEQAETKLIVPISSQRVNLEELHPYTVYMISIHAVTV
KPGPELTTNFTTEQDAPPPPRNLTAHQLSRTTLSLSWYPPYPPHGVLERYQIKFRTKGIR
NNSALLNVDQYKCSSENSDLERHCFTVTNLLPVTIYRFSGVEEPVVPVNFSDAQEMQLGY
YTAAMFSPEELREQSDFVLGAGNVVGGFENPPLTESTPYRIGLLVASNFSDEVRYGYRLS
EPVVVGKTDGTSEISIVLAGVLALLVLLALMSAALICFCIRRRSGPGSPRKRGPQDSLSR
LSKRSYYII
Download sequence
Identical sequences B7Q134
XP_002408891.1.51680 ISCW010030-PA 6945.ISCW010030-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]