SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010327-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW010327-PA
Domain Number - Region: 3-54
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000705
Family Galectin (animal S-lectin) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010327-PA
Sequence length 101
Comment hypothetical protein|DS887088:38999:42568:1|gene:ISCW010327
Sequence
MDVAVLEKEFHMAVNGQTLPPYNHKVFYGQGQFICIDKNVTVKNIRVCSISHPKHWTSKP
PNVKQASLIFHRSDAPASRQIMLDVGQCYYIQGTPPLHSQT
Download sequence
Identical sequences B7Q933
ISCW010327-PA 6945.ISCW010327-PA XP_002405556.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]