SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010356-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW010356-PA
Domain Number - Region: 117-245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000141
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 5-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.02
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010356-PA
Sequence length 306
Comment hypothetical protein|DS890282:912:2079:-1|gene:ISCW010356
Sequence
MDIRLTTSNPQVLSGVVTKYTCSAPFSADPSFRWYVDNEYVNTTTASALSIQVSGLSVER
TLDTEALAYSVLEIRAYQPKTGIVTCSVFIRGTGLTVSSAYVVTSEDDLLHASYNSSCTR
DTVCVDGNSSCSVDLRTRVSKCLCKRGYRHYSQLRANCAAHYGGIGSPCSSNQDCLEWDR
NAHCHNRRCSCKSPFSNEYRIGKCIKEVSLFGACSGEFMCLVEHSYCANHTCQCFPGRVY
DGNKCSLLREGEGLNFKKLFLIGLLIFSAITLLPMVIMATIRAVFTLMPLHQGSRGRRRR
IIIRLL
Download sequence
Identical sequences B7Q9N5
XP_002406175.1.51680 6945.ISCW010356-PA ISCW010356-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]