SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010434-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010434-PA
Domain Number 1 Region: 23-86
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000675
Family Growth factor receptor domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010434-PA
Sequence length 112
Comment secreted protein, putative|DS875378:6982:10866:-1|gene:ISCW010434
Sequence
MKTTLCLFVLVGVSTICILGTSLLDCPTCSEVQCREPAGSCQCGNYTTHCGCCHRCFKCA
GEVCKPRLRDICQSEYECNVQVTAPNDPDFDVFGTCTYIPTTRRPRPEEYGG
Download sequence
Identical sequences B7Q7H8
ISCW010434-PA XP_002404054.1.51680 6945.ISCW010434-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]