SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010470-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW010470-PA
Domain Number - Region: 29-93
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0122
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW010470-PA
Sequence length 195
Comment hypothetical protein|DS872438:5035:15437:-1|gene:ISCW010470
Sequence
MGGVLFENIALRHTQKPCLFSETCSAVDAHSRCAKGSCECLQGHEVHHVGACRRWASYDQ
QCDNKVHCLEEGVECVDGVCMCDRGRLRFNGTCQVVDEGLGSLNVRQKTALGGSVFLTMT
GVILALTNLCHGRWSRRERKTLADDEKPMTSAIRSASFPEWADANSCYMSTRYWVSEQPY
YSLPQRKHHKMYFKW
Download sequence
Identical sequences B7Q769
6945.ISCW010470-PA ISCW010470-PA XP_002403718.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]