SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010611-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW010611-PA
Domain Number - Region: 13-140
Classification Level Classification E-value
Superfamily NHL repeat 0.00146
Family NHL repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW010611-PA
Sequence length 203
Comment myocilin, putative|DS870771:30909:31535:-1|gene:ISCW010611
Sequence
MRDSHKRAFDASKFWVTLDGDHTTLLEYVDNNFSRRYSLPYAFRGNTQVVYNGSLYYHHE
NTDSIVRLDLGNKSTAALNLAEDFSSARLLYATQHNAMDILADENGLWVIYASSGSSNTL
VMKFHESAMKTERVWNLTLDHRTVGEMFIVCGVLYAVNSVHDVATRINFAFDLYEETAIE
MALNFSNPFRNTSXXSEVSRPLV
Download sequence
Identical sequences B7Q6Z3
6945.ISCW010611-PA XP_002403466.1.51680 ISCW010611-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]