SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010834-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010834-PA
Domain Number 1 Region: 331-399,434-528
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000115
Family Mannose 6-phosphate receptor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 259-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000487
Family Growth factor receptor domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ISCW010834-PA
Domain Number - Region: 57-88
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00133
Family TNF receptor-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW010834-PA
Sequence length 687
Comment conserved hypothetical protein|DS883282:3944:20572:1|gene:ISCW010834
Sequence
GSSECGTRPPCTSDDYFETRSPCDRNNQTTVSYEWVSPKVCDQRHQDSVHLPVSGKQVPC
PPCNPGMHHGSKYMCDYCPPGNYSDGYKARYPINRGNSTRASGACCNWAAASTSAGWGSC
RNATAWKALGSYIQSGQDHGEDAYLILQLDVGGFRSKGLMSGTRTTAFGTISFTFELDCV
GLCEFVFMQSSPRQGVSVVKSWSGRQEKQHFTRYMQFNDSYIFSWAFQRSGSDGTTSKNN
RRRQPEDSAIIYDIQVTNTVKGGAEKCMPCPEGSEAKGCIPCGAGQYIQDKENLVCQSCP
ANTYVSERLPYGIESCKPCGPGLRSENGRSCYSDCHVFLEHGQEFDFHTLPSFLELRGRK
LFTASGTQYYHAFNISLCGNDGKPVAMCTNNVTYHVRHISIDCWNLITFALCRSTIVPSQ
QSEISAPLSIQSVSLGDELIGITTKSSYNDISVIKEFLPGPGQKPDIHFFYYSSMPTQAC
QKGRATTITLRCDKNAGPNGTVTMPTSCPDGTCDGCTFHFLWSTALACRICMPDDYQVVK
GECISGVQKLHYISPQGCIPRGSTAETMTKTQPCSVIPRQLQIIIAIGVAMGVLLFGMLV
YFWKKNRKLEYKYMKLVASSSGKDGELPVAESCAIEEDEEDHFENGGYEAKNKGLLQKFR
TVRIGSGKSGEGHHFETIHLTKGEMVS
Download sequence
Identical sequences B7Q8E3
ISCW010834-PA 6945.ISCW010834-PA XP_002404979.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]