SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010876-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010876-PA
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily NHL repeat 0.000000011
Family NHL repeat 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010876-PA
Sequence length 116
Comment conserved hypothetical protein|DS884446:133813:137725:1|gene:ISCW010876
Sequence
MSKAAELVDVGTPDGHCVIVFSEEGHYLRKIGCDGVTNFPNGIDISDAGDVLVGDSHGNR
FHVVVFSREGSLLSEFECPYVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYIV
Download sequence
Identical sequences B7Q8J6
ISCW010876-PA 6945.ISCW010876-PA XP_002405170.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]