SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010905-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010905-PA
Domain Number 1 Region: 160-244
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000148
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 46-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000348
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 256-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000406
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ISCW010905-PA
Domain Number - Region: 333-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000689
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010905-PA
Sequence length 483
Comment sidestep protein, putative|DS879724:10600:31069:-1|gene:ISCW010905
Sequence
MASVTWPSNRVGVRSSPWSLIRSGTLEAGPQGMASNVAVSGAALKPSTVRIRSKQRPLAA
GLAAEIECEAAGSRPAPVITWWRGKEKLPTSHFKILLIGNRIFSVVAYTPTREDNGKKLR
CLAENPNLIGSSIEASYILDIYYKPVVRLQLGKRLRLEEIFQGQDLYLECSIDANPSVSE
VVWRFEGREVRSNPAAKVITSNQSLVFQAIQRQNAGRYICVAINSEGESESNEVHLRVQY
SPVCSSRQRTVYPAAAHEMVQVSCDVDAHPSVVSFRWAFNGTLRSHEVQSFVSEGGRSVA
SYVPREEADYGSLLCWGANDMGTQKTPCQFKVTPVGPPLAPSNCTLSNQTEEAFLAECHE
DHIGGPRQLYSLEVHDVSCHRLLANLTADRPAFWVQGVPAGLNVVLVLYAANRMGRSQPV
LLRAEAADRHWEGLRHGGEWNGCERSNYLVVILVAVTLITVFLLFLLVIVTRCRNKKRLK
ENI
Download sequence
Identical sequences B7Q808
6945.ISCW010905-PA XP_002404584.1.51680 ISCW010905-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]