SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011070-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011070-PA
Domain Number 1 Region: 44-203
Classification Level Classification E-value
Superfamily vWA-like 1.83e-37
Family Integrin A (or I) domain 0.0029
Further Details:      
 
Domain Number 2 Region: 307-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.06e-16
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 369-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 846-1013
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000107
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 428-484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000032
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 6 Region: 661-714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000695
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ISCW011070-PA
Domain Number - Region: 586-647
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0298
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW011070-PA
Sequence length 1021
Comment hypothetical protein|DS853260:204158:261698:1|gene:ISCW011070
Sequence
MSGALVVFVKGYIFISACLCASSFALQYVQAEEPHGNVFDWRGIESNNTDLVFLLDRSGS
VGQAGFEVETGFVHAFLKGFDVAPNTTRVAVISFSEDAVVHADFLKDPGNKCHLSRKMQG
VHSANQGATNTGAGLQAAWEVFQRSRPTAKKLLILVTDGMATMGPDPVKKAEKLKNMGVD
IFVFGIGRMLKQHLEQLASTPANVSDPYRGQPDDPGCCDKNAICGCSMATGTSNCLCGPG
FEGTGLEGQCKACNPGTYKEEHDDKTRCKSCPQNSTTAHEGSRSIKDCVCKKAHVGDPTA
GKPCVPVTCPPLQPPEHGSIIDECSTAYKSECEFDCDEGFELMEQESGVRTCQEDGTWSG
ATVVCVPKQCDEPPIPENGYADGCDGDRAVGTTCTYSCIQGHRLVGESTTVCTPHKTWTN
TGAACNPVECPPPPFPAYAARLGDFRRSRPYFYKDYIKPQCLSGFELQGPVIIMCEANGQ
WLGPDNQSALFSCVDKEKPQIQCPQDEERHAEARRSYARIAWSQPEVKDNSGEVPFIQKM
PENITSPWRFPIGKTEIRFKATDAARLSAVCTFTVTVLDEEKPLMTSCPQDIHVNTTDLK
VKVSWREPLFEDNSGYVYVKQSHHPGSEFTQGSTKITYTGTDGSRNTERCVFKVVVSKSE
CPYHPPPENGALSCDSWLHGEFCQPFCNERFDFLDEPAEEYICDKDRTWQTVPPGLPVPW
PDCAATTEPLEHRRLLRAHYYTGDCREAHVQEAIKRAFRNNYYSRVQKTVLCGSGALCKL
DNVRVKCGRTGDANPPPSGTVTVRHRRSLDTPVADEPNSVAELDAEFSLVLSVTICPSGT
FHDMEKDLCSPCPMGTYQDDDGRTSCKSCPNGTSTEAPKRKSLDDCQPPCAPGTYSSTGL
GPCMACPQGTFQDKTQQTFCQFCPRGSTTEGIGSLVKDNCKRYCQPGSYSKNGLEPCQLC
PRGFYQTTQGQKTCQECRVPTTTLQEGSKSSFDCILVDHCSSAPCSNGTCRNTQHGFLCE
P
Download sequence
Identical sequences B7Q412
ISCW011070-PA 6945.ISCW011070-PA XP_002411442.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]