SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011089-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011089-PA
Domain Number 1 Region: 433-699
Classification Level Classification E-value
Superfamily NHL repeat 2.09e-35
Family NHL repeat 0.000000000203
Further Details:      
 
Domain Number 2 Region: 77-112
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000847
Family B-box zinc-binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 2-35
Classification Level Classification E-value
Superfamily RING/U-box 0.000000884
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW011089-PA
Sequence length 701
Comment xnf7, putative|DS853260:920951:941358:1|gene:ISCW011089
Sequence
PQVLNCLHTFCQLCLEKEVTGDKVRCPQCQQDSPLPPGGTAGFPSDYAVSNILETAALEE
ASLGCTGARDGLRAPQDKPVACLRHRTEALRYFCRSCDTPVCKECTLLDHPKAQSLSRVA
SVVRFSVPCLHRDVEAVLGRLLLSIKTPSRGTARALRAHSNAAGSRVWPMVSFLATLQRR
QIRTVGLSVAAGSTTNEFLHAWPQVQDTIERIHQVCAFVERLTRFSTSTEALVFKQLLEA
KFQGFLSFRPESGLHNMDLEFVSNFQAIQVGVRNTFGYIKQGGASDNHGVPRQPPIARPN
GVVLSASDRSGVVATTIATSHQNGHHPPPPPTSPFESNLLSKRFSSANSLGPFSTSLADV
SPYEKWSSGGGGDIFQNGTDYGTAPEPPSVLPVGGGSSGGGSTTTALAELSSKYLSGSGV
GLYPLKSQIKRQKMIYHCKFGEFGVMEGQFTEPSGVAVNAQNDIVVADTNNHRIQIFDRE
GRFKFQFGECGKRDGQLLYPNRVAVVRQSGDIVVTERSPTHQIQIYNQYGQFVRKFGAVI
LQHPRGVAVDPKGRVVVVECKVMRVIIFDQGGNVLQKFGCSKHLEFPNGVVVNDRQEIFI
SDNRAHCVKVFSYDGNFLRQIGGEGLTNYPIGVCMNQGGEILVADNHNNFNVTVFTQDGQ
LVNALESKVKHAQCFDVALMDDGSVVLASKDYRLYVYRYVQ
Download sequence
Identical sequences B7Q429
XP_002411459.1.51680 ISCW011089-PA 6945.ISCW011089-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]