SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011259-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011259-PA
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 94-195
Classification Level Classification E-value
Superfamily Immunoglobulin 9.67e-16
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 252-339
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000272
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ISCW011259-PA
Domain Number - Region: 215-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000384
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW011259-PA
Sequence length 424
Comment sidestep protein, putative|DS861031:67922:84881:-1|gene:ISCW011259
Sequence
MDMGPLSVSIVGGQPTLEAGRPSSLRCVSSGSRPPATLSWWKGTQRLPATADGSASTLAI
TPVTEDDGQQLSCRAVNEQLPQASLEDLVTLRVLYKPLLTLRLGNRLREDSILENHDVYL
ECNVAANPPVVDITWLFDGHDLQTNTTAGVIVSNRSLVLQKVGRSARGEYQCAASNALGQ
SRSAALFLRVQFAPICHEPQKWVYGSAKHEPIQGATRSVATFVARSEADYGTLRCEARNA
VGPQRWPCQFSVVPAGPPEAPGLCTLANQTEDAFQVHCSAGHHGGLPQHFVLEVHDSGGR
FRGNVTAPQPNFEVTDLPAGSDFVLVVYSANGKGRSSPVLLTAATLPAAAESLLHQGPEA
TWQVKFSPVLAVLMALVLGFALLAFVVVVAVRLWTRHSFHKDPQGHLHLPRAFAWPHWTR
ITLL
Download sequence
Identical sequences B7Q5E6
XP_002411746.1.51680 6945.ISCW011259-PA ISCW011259-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]