SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011349-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011349-PA
Domain Number 1 Region: 177-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-62
Family SPRY domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 381-420
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000445
Family SOCS box-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW011349-PA
Sequence length 423
Comment SPRY domain SOCS box-containing protein|DS891368:167940:198061:1|gene:ISCW011349
Sequence
MRPGRSVPSHLGGLVHAVAVLSPPSALVGPWLQQHGCVAARIAHHHHQQQHHHQFQLGER
FRVAFLVGARFTTDEFPFISEISRPLCHGLPPRCPSACVHEAPLVKALRRPLAPSALWRH
RRRANMGQKVTTGLKVDHPMEEVGSGLPSGLSGGVSGAGGVRGGAWASSGGAREPERPLR
LDLLLDMPPACGDLQGRHAWNPEDRSLNIFVKDDDRLTFHRHPVAQSTDCIRGKVGYTRG
LHVWEVRWSTRQRGTHAVVGVATREAPLHSVGYQSLVGSNRESWGWDLGRNKLYHDNKNN
PAVTYPSHCCRPSEEVFLVPDAFLVVLDMDEGTLAFVVEGRYLGVAFRGLRGKKLYPVVS
AVWGHCEITMKYIGGLDPEPLPLKDICRRVIRQRVGKSRLGRVPELNLPTALKAYLLYQD
RAS
Download sequence
Identical sequences B7Q9T5
XP_002412545.1.51680 6945.ISCW011349-PA ISCW011349-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]