SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011404-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011404-PA
Domain Number 1 Region: 14-44
Classification Level Classification E-value
Superfamily RING/U-box 0.00002
Family Variant RING domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW011404-PA
Sequence length 230
Comment membrane-associated RING finger containing protein, putative|DS870096:19053:26158:-1|gene:ISCW011404
Sequence
MPSPLRPRSIFDAGSLAKVHKTCLETWLGNQAIDQCEICKFHYVTARRPKGFHEWLINSS
TREDKQNLIGDMVALLLLTPLVVFSLWLCTEGAIQFSHEGFPTWESAGLVFITIVLFVVF
CVWVTLLYRYHYTIWKQWRSHNFHVNLLVKSNAPPVSEEVPLPPVAQQDPETTSQGDREE
VPSVVVEGVPDVRNDVDVPAERSIESPSSSPKESPPKSSSSTLIIYTEPA
Download sequence
Identical sequences B7Q6T0
6945.ISCW011404-PA ISCW011404-PA XP_002412030.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]