SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011485-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011485-PA
Domain Number 1 Region: 66-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-36
Family Laminin G-like module 0.00073
Further Details:      
 
Domain Number 2 Region: 622-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.94e-36
Family Laminin G-like module 0.00019
Further Details:      
 
Domain Number 3 Region: 448-618
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-35
Family Laminin G-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 235-406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-33
Family Laminin G-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW011485-PA
Sequence length 807
Comment laminin alpha-4 chain, putative|DS878752:6736:33946:-1|gene:ISCW011485
Sequence
MDEPWPILRGFRAQVELGDWVPFVGFLEELEFGGLPLGLWNFLEKGGELMGCAERDVLAQ
VPGGSGLRFDGTGYAILSKERRDFSSGISISMQFRTFAKEGLLFLIHNGPKFMALELRDG
HVVYKFDLGSGTTELRSDAAYNDGMWHQLRAAQLQMDADLTVGGNDSVTGRARGQEEGLD
STDDIFVGGHPSFHGHEEVTRVNFEGCIQDLELDTRLLDLHKTKEALAVTSGCPAIVARL
VSFSSPGYLAMPFLDLSEDSQLTFKFRTQRPDGLIFYASSQDHSSFLAVGLRGGRLFLQA
RPGGEVHTEASYDDGRWHYVTASFYSTRLRLDVDDGLVVQRSTQERVYVLTSSALYFGGL
PASQQPSEPLPPAFVGCLGDATVRGTLQNFAAATEHSNAVLASCPASYDEDLSTEETPHI
STGSSDSTPLPGCALPLEPARDIDVGPNSGLRFGNSPESRQEFRMPTDFANSLLEQSTVS
LEFRTRHEDGILFYVGNTNQVDFISIFMKQGRLNVMFNCGTGSGLLTTTETYNLGEWHSL
EFSRRGQVGLLYVDNATAVQGSSQGTTSSINVRAPIYFGGLPRNLSSQVKANFRGVTGSF
PGCMRKLEVQDRLLVRPKVSVGVTGCSQKVESGTFFGNNGSHLVLYDSYNVGKEMTVELD
IKPRRTSGVLFAVHSNNQKDFVLLQMVDGNVKFSVDNGAGIIAVTVSAGNLCDGQWHTVK
AVKNKNVLSLAVGSASNLAIGRGGVTATDTANPLYVGGVPDPGQTRAVESSDQFVGCVRY
LQINSKLQNLADSRVHGDVHLNSCPTI
Download sequence
Identical sequences B7Q7X5
XP_002412232.1.51680 ISCW011485-PA 6945.ISCW011485-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]